PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR01G27380.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family TCP
Protein Properties Length: 301aa    MW: 31948.5 Da    PI: 7.4425
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR01G27380.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP96.64.6e-3052134388
              TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssg 88 
                      g+kdrhsk+ T +g+RdRRvRls+++a++++dLqd+LG+ ++sk ++WLl++a ++i++l+ ++++++ ++   ++  +++++++ 
  LPERR01G27380.1  52 GGKDRHSKVKTVKGLRDRRVRLSVPTAIQLYDLQDRLGLNQPSKVVDWLLNAARHEIDKLPPLQFPPQGAA---DHLCMSHHHHHM 134
                      78*************************************************************99999333...333333322222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136929.95153111IPR017887Transcription factor TCP subgroup
PfamPF036341.2E-2753134IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MILGSSTNQQ SAAEEEAELA RKQTAAAAAA ATSRQWSAQT ESRIVRVSRV FGGKDRHSKV  60
KTVKGLRDRR VRLSVPTAIQ LYDLQDRLGL NQPSKVVDWL LNAARHEIDK LPPLQFPPQG  120
AADHLCMSHH HHHMAPSPAA MMMHHVDDKY HVAAMAAAAD KAGGGGAGDD VDGGHMVGRF  180
PAGGYHRFMG LNNPLGMVNT AAMPFHYAGG ESWNNNNNNN NGSVQDGIGA GSPQVAAAAA  240
AAAAHHSSAF PSLLSLAPGS HHHQLVFYSS EAEQFTVDNL GSQSLSLSSA RAFHDHDQTG  300
S
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0719641e-123AK071964.1 Oryza sativa Japonica Group cDNA clone:J013079O19, full insert sequence.
GenBankAP0032741e-123AP003274.4 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0512C01.
GenBankAP0149571e-123AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankCP0126091e-123CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.
GenBankCT8322131e-123CT832213.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSN047P02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015626531.11e-131PREDICTED: transcription factor PCF6-like
RefseqXP_015626542.11e-131PREDICTED: transcription factor PCF6-like
TrEMBLA0A0D9V6040.0A0A0D9V604_9ORYZ; Uncharacterized protein
STRINGBGIOSGA000770-PA1e-131(Oryza sativa Indica Group)
STRINGLOC_Os01g55750.11e-131(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24903584
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60970.11e-40TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 5